FeaturedToken FactoryAwesome AI Appsby @Arindam200Awesome AI Apps100+ runnable RAG, agent, and workflow demos — many powered by Nebius Token FactoryToken FactoryAI Cloudagentsrag
FeaturedToken FactoryAll Agentic Architecturesby @FareedKhan-devAll Agentic Architectures35 production-grade agent patterns (Reflexion, LATS, GraphRAG, MemGPT) with Nebius as the default LLM providerToken FactoryAI Cloudagentsrag
FeaturedToken FactoryOpenClaw + Nebiusby @opencolinOpenClaw + NebiusFork of OpenClaw with native Nebius Token Factory inference.Token FactoryOpenClawagentsframework
FeaturedToken FactoryLogoAIby @Arindam200LogoAIAI logo generator powered by Nebius AI StudioToken Factoryappimage-generation
FeaturedToken FactoryReal Estate AI Agentby @brightdataReal Estate AI AgentStructured property data extraction with the Nebius Qwen LLMToken Factoryagentsdata-extraction
FeaturedToken FactoryADK Agent Examplesby @AstrodevilADK Agent ExamplesGoogle ADK agents running open models on Nebius Token FactoryToken Factoryagentsadk
FinalistAshaby @mohammed-misran · Robotics hackAshaWhatsApp-native AI assistant for small home-based food businesses.llamanextjssupabase
★ Runner-upChase Brignacby @chase-brignac · Robotics hackChase BrignacGenerating the first human preference datasets for robot policies in simulation with Nebius GPUs to understand which policies work best in an objective way using ELO ratings and anti-cheating measurestypescriptrobotics
★ WinnerInjesterby @alex-shirazi · Robotics hackInjesterInjester is an AI-native engine that transforms "agent-hostile" websites into structured data interfaces.tavilyagents
Finalistjimmyby @armin-foroughi · Robotics hackjimmyVoice-controlled Booster K1 humanoid robot.pythontypescriptros2robotics
FinalistLatent Signalby @ann-catherine-jose · JetBrains hackLatent SignalPeriscope is a local-first viewer that shows exactly what's in your coding agent's context window, turn by turn, and recommends the next move (compact / branch / fresh / rewind).agentsjetbrains
FinalistPinpointby @het-patel · JetBrains hackPinpointVisual annotation overlay for frontend review — pinpoint things in complex software.
★ 3rdOpenClawRoboStoreby @joshua-iokua-albano · Robotics hackRoboStoreRoboStore is a self-expanding robot agent platform that enables robots to autonomously detect their own capability gaps, search for hardware solutions in real-time using Nebius LLMs, and auto-generateOpenClawtypescriptagentsrobotics
★ Runner-upScopecreepby @bhavik-sheoran · JetBrains hackScopecreepTurns JetBrains IDE into an agentic hardware testbench.pythontypescriptagentsjetbrains
FinalistSecureLoopby @peyton-li · JetBrains hackSecureLoopTurns production Sentry alerts into Codex-generated, sandbox-tested, human-approved fixes inside JetBrains.typescriptjetbrainscodex
★ Winnerthinkingby @aditya-mangalampalli · JetBrains hackthinkingSelf-healing coding agent that searches over compact DSL implementation plans before generating code.rlagentscodex
FinalistTopologyby @nigel-robinson · Robotics hackTopologyEvolutionary agent-org discovery — 10 teams of LLM agents compete on a task with randomly generated organizational genomes (hierarchy, communication, decision-making).typescriptdeepseekagents
AI CloudNebius Llama-3 Multi-Tool Agent (Marktechpost)by @MarktechpostNebius Llama-3 Multi-Tool Agent (Marktechpost)Multi-tool ReAct agent tutorial built on Nebius AI Studio with ChatNebius, NebiusEmbeddings, and NebiusRetrieverAI Cloudagentsrag
Token FactoryGen-AI Experimentsby @buildfastwithaiGen-AI Experiments130+ generative-AI notebooks including a LoRA fine-tuning guide on Nebius Token FactoryToken Factoryfinetuningagents
AI CloudTemporal AI Agent Pipelineby @FareedKhan-devTemporal AI Agent PipelineTime-aware knowledge-graph ingestion pipeline using Nebius for embeddings and DeepSeek-V3AI Cloudagentsrag
AI CloudPothole Detection (YOLO)by @PeterHddPothole Detection (YOLO)YOLOv8 pothole detection trained and served on Nebius CloudAI Cloudappcomputer-vision
Token FactoryRAG with Nebius + Postgresby @fsndzomgaRAG with Nebius + PostgresDocument Q&A RAG using Nebius models and pgvectorToken Factoryapprag
Token FactoryReview Intelligence Agentby @brightdataReview Intelligence AgentCross-platform review analysis with Nebius-served LLMsToken Factoryagentsanalytics
Token FactoryDevScribe AIby @dev-rashedinDevScribe AIText-to-text writing assistant powered by Nebius StudioToken Factoryappwriting
Token FactoryWhatsApp Bot on Nebiusby @nataondevWhatsApp Bot on NebiusMinimal WhatsApp assistant on Nebius AI StudioToken Factoryappchatbot
Token FactoryNebius AI on Hono + Cloudflareby @Arindam200Nebius AI on Hono + CloudflareStreaming chat app using Nebius models on CloudflareToken Factoryappchatbot
Token FactoryClaude Code Proxy for Nebiusby @KiranChilledOutClaude Code Proxy for NebiusRun Claude Code against Nebius Token Factory models. Drop-in proxy that converts Claude Code requests to OpenAI-compatible Nebius calls, with a TUI installer, smoke test, and an observability dashboard. Fork of fuergaosi233/claude-code-proxy adapted for Nebius by @KiranChilledOut.Token Factoryproxyclaude-codepython
Token FactoryLLM Chess Tournamentby @fsndzomgaLLM Chess TournamentBenchmark LLMs at chess using Nebius AI Studio modelsToken Factoryappbenchmark
AI CloudPremiseby @SubThoughtPremiseA stigmergic agent language for coordinating self-improving agents.AI Cloudself-improving-aiagentshackathon
Token FactoryRAG Cookbook 2026by @FareedKhan-devRAG Cookbook 202640 production RAG recipes, Nebius-firstToken Factoryapprag
Token FactoryUniversal Deep Researchby @demianarcUniversal Deep ResearchStrategy-driven deep research agent on Nebius AI StudioToken Factoryagentsresearch
TavilyAirReserveby @anshk8AirReserveReal-time flight booking and price tracking; won Best Use of Tavily at AI Tinkerers Ottawa's Vibe Code Hackathon.Tavilyagentshackathontravel
Token FactoryMorphix AI Image Generatorby @Rohit-1717Morphix AI Image GeneratorFLUX.1-dev text-to-image via Nebius AI StudioToken Factoryappimage-generation
Token FactoryNewsletter Agentby @atulranjan45Newsletter AgentAI newsletter generator on Nebius AI + Agno + FirecrawlToken Factoryagentscontent
TavilyIntelli-Creditby @ratneeshhIntelli-CreditAn AI credit appraisal engine that reads financials, researches the company on the web, and writes a bank-grade memo in minutes.Tavilyagentshackathonfintech
AI CloudSentienceby @SubThoughtSentienceBuilding sentient beings — a self-improving agent experiment.AI Cloudself-improving-aiagentshackathon
Token FactoryVehicle Diagnostic Assistantby @castlebbsVehicle Diagnostic AssistantAn AI agent that plugs into your car's OBD-II port and diagnoses issues over chat.Token Factoryagentshackathonmcp
TavilyVirallForgeby @fabienstraussVirallForgeA canvas-based AI workspace for generating platform-optimized social content with live web context.Tavilyagentshackathoncontent-generation
Token FactoryAlanby @leo-arsAlanA real-time voice AI assistant for healthcare with streaming STT, RAG medical lookup, and TTS in one session.Token Factoryagentshackathonvoice
TavilyAutonomixby @HiNalaAutonomixAn autonomous multi-agent codebase intelligence engine with live CVE security analysis.Tavilyagentshackathonsecurity
AI CloudClinical-RAGby @SchadenKaiClinical-RAGCitation-backed medical RAG with Nebius as a pluggable LLM and embedding providerAI Cloudragagents
Token Factorydata-oncallby @benikigaidata-oncallPage a team of agents instead of waking up your on-call engineer for data quality bugs.Token Factoryagentshackathondata-quality
Token FactoryFlightBrief AIby @grcodemanFlightBrief AIAn AI flight-briefing app that earned a top-5 finish at the localhost AI hackathon.Token Factoryhackathonaviationlocalhost-ai-hackathon
AI CloudJob Finder Agent (MCP Server)by @RamakrishnaTanamJob Finder Agent (MCP Server)LinkedIn-to-jobs agent using Nebius AI Studio Llama-3.3-70B for analysisAI Cloudagents
AI CloudLocalTinkerby @tmcLocalTinkerA local harness for tinkering with self-improving agents.AI Cloudself-improving-aiagentshackathon
OtherAF*by @div-agarwal · JetBrains hackAF*AI Forward-Deployed Engineer for ERP data ingestion — onboards unknown ERP systems automatically using multiple agents that research, improve iteratively, and deploy the pipeline.typescriptagents
AgentCommerceby @diego-zuluaga · Robotics hackAgentCommerceTwo AI agents (Buyer + Merchant) negotiate purchases end-to-end with zero human intervention.typescripttavilyagents
agent + humanby @seshadri-venkatesh · Robotics hackagent + humanBot reaches a waypoint based on streaming Pi camera data; logs success/failure to JSONL; an analyzer agent improves the bot's objective from the log.agents
AI CloudAI Humor Enhancerby @actionstockplus-uiAI Humor EnhancerA self-improving AI that benchmarks and enhances humor.AI Cloudself-improving-aiagentshackathon
TavilyAI News Scout (Tavily + Nebius)by @abrl91AI News Scout (Tavily + Nebius)Tavily search + Nebius embeddings AI/ML news brief agentTavilyToken Factoryagentsresearch
AI CloudAI Traderby @KaushikSivaAI TraderA self-improving AI trading agent.AI Cloudself-improving-aiagentshackathon
AI Warehouse Fulfillmentby @nelson-lai · Robotics hackAI Warehouse FulfillmentLLM-powered warehouse robot that reasons, routes, and adapts to chaos in real-time on Nebius.typescriptrobotics
Token FactoryArclight Bioby @nayanikarArclight BioAll experts at the tableToken Factorybiohackbioagentshackathon
arm-pilotby @sota-miyajima · Robotics hackarm-pilotAutonomous task discovery — robot receives a job command, Nebius LLM searches the internet for the most suitable task, motion data is retrieved and deployed.tavilyrobotics
OtherArtificial Sixyby @hades-li · JetBrains hackArtificial SixyAdaptive Change Harness — self-evolving verification + repair system for real codebases.typescript
Token FactoryAutoEvolveby @miaosen-zhou · Robotics hackAutoEvolveCloud-side task planner runs Qwen 2.5 on Nebius Token Factory as a reasoning layer.Token Factoryqwen
AutoRobotsby @warner-wu · Robotics hackAutoRobotsAutonomous AI scientist that teaches simulated robots to move.typescriptrlagentsrobotics
OtherAW3 Technologyby @william-schulz · Robotics hackAW3 TechnologyOpen-source digital vision CLI tool and dashboard.
OtherBerkeley Baris Boysby @noah-lund-syrdal · JetBrains hackBerkeley Baris BoysBlueprint — PyCharm plugin that helps developers plan a codebase architecturally before implementation.typescriptjetbrains
Token FactoryBlueby @WeilanBluePersonalized skincare planning for sensitive skinToken Factorybiohackbioagentshackathon
AI CloudBotcachinoby @willypaz243BotcachinoFastAPI + LangGraph university-info agent with Nebius as the default LLM providerAI Cloudagentsrag
Token FactoryBrain Organoid Morphological Classifierby @shirazbhedaBrain Organoid Morphological ClassifierAutomated QC for stem-cell-derived brain organoidsToken Factorybiohackbioagentshackathon
Token FactoryBrewMindby @Helen ZhangBrewMindBiodesign, acceleratedToken Factorybiohackbioagentshackathon
Token FactoryCall Bullshitby @timotifCall BullshitReal-time voice fact-checker that talks over you the moment you say something false.Token FactoryTavilyagentshackathon
CaseSnipe.aiby @brandon-tautuan · Robotics hackCaseSnipe.aiMulti-agent courtroom simulation where AI agents argue opposing sides of real cases; a Judge agent delivers the verdict.typescripttavilyagents
CHAIby @vatsal-bajaj · Robotics hackCHAICompanion Humanoid AI for Unitree G1: detects approaching humans, greets them, and clears obstacles to act as a guide for visually impaired users.typescriptmujocollamarobotics
Token FactoryChainMailby @daniel-kaneshiro · JetBrains hackChainMailCouncil of specialized models deliberates and votes before any AI-generated change touches the codebase.Token Factory
AI CloudCheki-Bot Serverby @Cheki-botCheki-Bot ServerFastAPI + LangChain conversational AI with a dedicated Nebius agent and embeddingsAI Cloudagentsrag
TavilyClaim Verifier (MongoDB x Tavily)by @spaboluClaim Verifier (MongoDB x Tavily)A FastAPI agent that verifies claims by orchestrating Tavily MCP search plus LLM reasoning.Tavilyagentshackathonfact-checking
OpenClawClaw2Max - MechDog skillby @max-maximilien · Robotics hackClaw2Max - MechDog skillCreated an OpenClaw skill and simulator for the Hiwonder MechDog robot.OpenClawrobotics
Token FactoryClawBenchby @Hank-MoogyClawBenchCoding-agent model router benchmarked on Nebius Token FactoryToken Factoryagentsbenchmark
Token FactoryClawditby @yuwen-wu · Robotics hackClawditAuto-discovers an OpenClaw agent's linked Google account and makes it send malicious emails/calendar invites to itself.Token FactoryOpenClawtypescriptllama
OthercloneSMPby @sean-chiu · Robotics hackcloneSMPManhunt by AI — multiplayer manhunt game driven by AI agents.typescriptagents
Code Linguaby @kaushik-sivakumar · JetBrains hackCode LinguaCode with voice in non-English Indic languages (Tamil, Hindi, Bengali).typescriptvoicejetbrainscodex
OtherConMan Agentsby @sabeen-shaikh · Robotics hackConMan AgentsAutonomous contract intelligence for healthcare companies — agents continuously monitor all company contracts to identify changes (expiry, clauses, market developments) and proactively alert on next stypescriptagents
Token FactoryControlled Frictionby @irina-poslavsky · Robotics hackControlled Friction"Controlled friction" in software deployment using Tavily Search on Nebius Token Factory — intentional pauses, checks, and manual validations to boost safety, quality, and compliance during shipping.Token Factorytavily
Token FactoryCovalenceby @Jihyun ParkCovalenceAgentic bi-directional clinical trial & decision supportToken Factorybiohackbioagentshackathon
CrecerSparkby @mario-toribio · Robotics hackCrecerSparkAutonomous robotic tour guide with intelligent obstacle avoidance, natural-language interface for visitor queries, and a management dashboard for custom routes.robotics
Token FactoryCross-Source Join Advisorby @fchadwickirCross-Source Join AdvisorAutomatically test every join across data sources and flag the risky ones before anyone writes a query.Token Factoryagentshackathondata-quality
OtherCueby @sajjaad-farzad · JetBrains hackCueA coding agent with as many tools as you need — handcrafted UI, your next move on cue.agents
AI CloudDarwinian SIAby @kshivam4781Darwinian SIAAn evolutionary approach to Self-Improving AI agents.AI Cloudself-improving-aiagentshackathon
OtherDav Yaginumaby @dav-yaginuma · JetBrains hackDav YaginumaPlugin that adds a Spatial pane to the IDE plus MCP commands so an agent can render anything in 3D spatial visualizations — projects, algorithms, narratives.typescriptagents
Otherdayopsby @kian-kyars · Robotics hackdayopsMinimal backend for voice-memo planning into Google Calendar.voice
TavilyDeep Research MCP Studioby @akovalevskyiDeep Research MCP StudioA TypeScript MCP deep-research agent that turns a query into a cited report, a mindmap, and a two-voice audio podcast.Tavilyagentshackathondeep-research
OtherDoubleYby @yue-chen · JetBrains hackDoubleYIntelliJ plugin that scans a React project and draws an interactive component graph in a side panel — beginners see parent-child structure at a glance and jump to source from nodes.reactjetbrains
Otherdronomyby @suvasis-mukherjee · JetBrains hackdronomyAI agent that migrates production ROS1 codebases (44 packages, 3,773 breaking changes) to ROS2 Jazzy.typescriptros2agents
Token Factorydronomy.ioby @suvasis-mukherjee · Robotics hackdronomy.ioDockerized autonomous drone simulator with full robotics stack: 24-ray LiDAR SLAM, EKF state estimation, A* + DWA planning, 8-state FSM.Token Factoryllamarlagents
OtherElectricgoatby @yaxin-wang · Robotics hackElectricgoatPrism — a private edge inference agent that refracts your biometric stream into a personal performance forecast and acts autonomously on your behalf.typescriptagents
OtherFBX2Robotby @reza-sanatkar · Robotics hackFBX2RobotAutomated pipeline that translates standard 3D human animations (FBX) into AI training data, eliminating hours of manual formatting so the Unitree G1 can learn complex movements.typescript
Framewiseby @aishwarya-gune · Robotics hackFramewiseCuts robot perception costs 80–90% by never sending the same scene twice.typescriptqwengemmatavily
OtherFrostbyte (zayd)by @zayd-khan · Robotics hackFrostbyte (zayd)Hooke is a research assistant for bench scientists — turns a scientific question into a usable starting point by combining literature, computational analysis, and model-based insight into one brief.typescript
Token FactoryGenoFitby @krxstxnaGenoFitYour genes, your data, your edgeToken Factorybiohackbioagentshackathon
Token FactoryGenomicWatchby @Ryan GermanGenomicWatchEnding the information blackout between appointmentsToken Factorybiohackbioagentshackathon
Token FactoryGitHub Repo Analyzerby @emanuelam00GitHub Repo AnalyzerFastAPI service that summarizes any repo with Llama-3.3-70B on Token FactoryToken Factoryagents
Othergoldfishby @cal-cu · JetBrains hackgoldfishEvolving AI agent that learns from every interaction — builds a persistent understanding of preferences, picks up new skills on the fly.agentsjetbrains
Grocery StockSenseby @mansi-mane · Robotics hackGrocery StockSensePhoto of fridge → AI inventory using Qwen2.5-VL-72B on Nebius Cloud.robotics
OtherGuardiaby @steven-yang · JetBrains hackGuardiaDeployment risk copilot integrated in JetBrains IDE that proactively alerts about risks before deployment.typescriptjetbrainscodex
Token FactoryGutGuruby @Luay YounusGutGuruThe observation layer your physician was missingToken Factorybiohackbioagentshackathon
Token FactoryHeraby @Jesse LinsonHeraThe latest research in your handsToken Factorybiohackbioagentshackathon
★ WinnerToken FactoryHistoGenby @aonkondey01HistoGenEnabling tumor boards with AI-assisted pathology-derived dataToken Factorybiohackbioagentshackathon
OtherHorizon Minby @david-mayboroda · Robotics hackHorizon MinFine-tunes a vision-language model to play classic NES Duck Hunt from raw pixels.vision
Token FactoryHsenceby @AlbinaKrasykovaHsenceAI-powered hormonal intelligence platformToken Factorybiohackbioagentshackathon
OtherHUMMINGBIRDby @lyona · Robotics hackHUMMINGBIRDTool for clinical-trial biospecimen vendors that automatically identifies samples submitted but never resulted, replacing manual Excel work with regulatory context and an audit trail.
Token FactoryIChatClient with Nebius Token Factoryby @EdCharbeneauIChatClient with Nebius Token Factory.NET console chat sample wiring Microsoft.Extensions.AI to Token FactoryToken Factoryagents
Token FactoryInferomicsby @timjtrainorInferomicsPareto-frontier model picker built on Nebius Token FactoryToken Factoryappbenchmark
AI CloudJanuSQLby @Kush614JanuSQLA self-improving text-to-SQL agent that rewrites its own harness across generations — 75.8%->93.3% execution accuracy with the model held fixed.AI Cloudself-improving-aiagentshackathon
OtherJCby @janice-chan · Robotics hackJCTests whether chaos engineering / chaotic exploration patterns speed up robot learning.typescriptrobotics
JetBioby @mahtabin-rodela · JetBrains hackJetBioReimagined IDE for computational biology that treats biological correctness as a debugging target.typescript
OtherLabPilotby @rajat-patel · Robotics hackLabPilotAI copilot for experiment optimization in pharma R&D labs.
Token FactoryLangGraph Customer-Service Data Analystby @DanibaraLangGraph Customer-Service Data AnalystReAct data-analyst agent over the Bitext support dataset, served by Token FactoryToken Factoryagents
AI CloudLatticeby @RoudranilLatticeOpinionated deep-research agent for physics PhD work, running tools on NebiusAI Cloudagentsrag
OtherLintropyby @jelle-maas · JetBrains hackLintropyRust-based linter and LSP server that lets you define repo-specific rules in YAML using tree-sitter queries + regex.typescriptagents
OtherMac Inference with an agent swarmby @travis-cline · Robotics hackMac Inference with an agent swarmDistributed autoresearch with a swarm of Macs linked through a collective intelligence cloud.
Token FactoryMCP Server on Nebius Serverlessby @mesutoezdilMCP Server on Nebius ServerlessClaude Desktop MCP server that forwards tool calls to Token Factory embeddingsToken FactoryAI Cloudagentsinfra
Token FactoryMetadata Incident Copilotby @King-DylanMetadata Incident CopilotA metadata-grounded copilot that makes safer incident recommendations because DataHub context changes the answer.Token Factoryagentshackathonincident-response
Miki the Robotby @linda-mao · Robotics hackMiki the RobotRobot companion that notices emotional changes and provides physical and emotional support.robotics
AI CloudMLX-Go SIA (Apple Silicon)by @tmcMLX-Go SIA (Apple Silicon)Self-Improving AI on Apple Silicon via MLX and Go.AI Cloudself-improving-aiagentshackathon
Token FactoryMRK III — QUALForgeby @Kevin OrtizMRK III — QUALForgeGMP qualification binder, automatedToken Factorybiohackbioagentshackathon
SoperatorNebius Slurm ML Training and Inference Demoby @kreuzhoferNebius Slurm ML Training and Inference DemoDistributed LLM fine-tuning and vLLM serving on a Soperator Slurm-on-Kubernetes clusterSoperatorAI Cloudfinetuninginfra
Token FactoryNebius SpecimenAIby @WeichengLiteNebius SpecimenAIFine-tuned biomedical specimen-triage agent built on Token FactoryToken Factoryagentsfinetuning
Token FactoryNeuroDiscover AIby @Alia MerchantNeuroDiscover AIMining evidence for directionToken Factorybiohackbioagentshackathon
OtherNikhil's Teamby @nikhil-tarigonda · JetBrains hackNikhil's TeamTwo-tool platform: Excel + PPT template → executive-ready slide deck (for non-technical users) and feature-request → AI-generated diff → human-approved deploy (for technical users).
Niwa (Self Improving Robots)by @andres-nino · Robotics hackNiwa (Self Improving Robots)Self-improving robots — continual reinforcement learning in sim for zero-shot transfer to playing Jenga.typescriptrlrobotics
OtherNOC AIby @mason-drake · Robotics hackNOC AIAI-powered Network Operations Center — Prometheus alert fires, an LLM agent analyzes the threat and executes iptables rules via SSH, all visible in a real-time chat UI.agents
★ 3rdToken FactoryPB&Jby @antmbraunPB&JPredicates, Building, and Journey — navigating 510(k) submissionsToken Factorybiohackbioagentshackathon
OtherPhantomby @vince-r · JetBrains hackPhantomPR Autopilot — AI code review suite that analyzes every pull request for architectural integrity, deployment risk, and technical debt.
Token FactoryPhaseZeroby @arshleenn-kaurrPhaseZeroPharma portfolio insurance before the wet labToken Factorybiohackbioagentshackathon
★ Runner-upToken FactoryPhoenixby @ShaivpidadiPhoenixAgentic evidence engine for clinical trial rescueToken Factorybiohackbioagentshackathon
OtherPool Watchby @andrzej-firek · Robotics hackPool WatchPrivacy-first, on-device drowning detection pipeline.typescript
AI CloudPregGoby @Hitha-Shree04PregGoMaternal-health emergency assistant with a Nebius-powered consultation chatbotAI Cloudragagents
OtherPulseby @yu-chen · Robotics hackPulseMobile-first AI app: send an AI agent (with packaged context: voice notes, docs, calendar) instead of repeatedly explaining yourself.typescriptagentsvoice
Otherquasa0.comby @anatolii-zhukovskyi · JetBrains hackquasa0.comJetBrains plugin in WebStorm that turns the IDE into a hands-free voice coding partner.voicejetbrainscodex
RedGreenby @rudy-a · JetBrains hackRedGreenJetBrains plugin that turns the IDE into a self-healing runtime.jetbrains
OtherRobo_chatby @sameer-shah · Robotics hackRobo_chatChat with robo — chat interface for a simulated robot.robotics
Token FactoryRoboMindby @0-5-blood-princeRoboMindTalk to a Unitree G1 humanoid in plain English; the LLM reasons, predicts the outcome in MuJoCo, and only acts if it's safe.Token Factoryroboticsagentshackathon
OtherRobot Agentby @brennan-stehling · Robotics hackRobot AgentMac app that uses an LLM to make tool calls to move a simulated robot arm.robotics
OtherRobots For Social Goodby @deon-menezes · Robotics hackRobots For Social GoodMultimodal humanoid robotics system that learns socially beneficial behaviors from real-world human demonstrations.visionrobotics
rOCDbotby @kirill-igumenshchev · Robotics hackrOCDbotUses LLM familiarity with OCD to make higher-precision robots.typescriptrlrobotics
Rodexby @yuvraj-gupta · JetBrains hackRodexCursor-style IDE that uses 4 AI agents (Nebius coding model + Blaxel sandboxes) for real-time security analysis, bug detection, and autonomous fix application on Python codebases.pythontypescriptagents
OtherRuntimeFixby @nelson-lai · JetBrains hackRuntimeFixDebugger-aware bug-fixing agent that actually sees what broke.agents
OtherSafevibingby @emahatsion-issac · JetBrains hackSafevibingReviews vibe-coded repository output for security, design quality, explainability, and engineering metrics.
Token FactoryScientific Consensus Engineby @Shyam DesiganScientific Consensus EngineAdversarial multi-agent hypothesis debate powered by NebiusToken Factorybiohackbioagentshackathon
AI CloudSEC 10-K / 10-Q Q&A Agentby @CuriousDimaSEC 10-K / 10-Q Q&A AgentA self-improving agent for question-answering over SEC 10-K / 10-Q filings.AI Cloudself-improving-aiagentshackathon
AI CloudSelf-Improvement Agentby @TatianaUshakovaSelf-Improvement AgentA self-improving AI agent built for the SIA Agents hackathon.AI Cloudself-improving-aiagentshackathon
AI CloudSentinelby @ankitshah009SentinelA self-improving agent for authenticity detection.AI Cloudself-improving-aiagentshackathon
Token FactorySentinelby @Atharv JayprakashSentinelFinding patients for trials from their wristToken Factorybiohackbioagentshackathon
OtherShadowDanceby @christopher-mckenzie · Robotics hackShadowDancePython package for observability, tracing, logging, and cost-tracking from cloud to claw with one line of code.python
ShopAgentby @victor-park · Robotics hackShopAgentAI shopping assistant that searches both major retailers and small businesses simultaneously.typescript
AI CloudSIA Agent — ayaelnakebby @ayaelnakebSIA Agent — ayaelnakebA Self-Improving AI Agents hackathon submission built on the SIA framework.AI Cloudself-improving-aiagentshackathon
AI CloudSIA Agent — hsehskadby @hsehskadSIA Agent — hsehskadA Self-Improving AI Agents hackathon submission built on the SIA framework.AI Cloudself-improving-aiagentshackathon
AI CloudSIA Agent — rayshineeeeeby @rayshineeeeeSIA Agent — rayshineeeeeA Self-Improving AI Agents hackathon submission built on the SIA framework.AI Cloudself-improving-aiagentshackathon
Token FactorySIA Haggleby @Leapfrogger-aiSIA HagglePredicts the final price of a Craigslist negotiation from a truncated transcript, running on the Nebius Token Factory API.Token Factoryself-improving-aiagentshackathon
AI CloudSIA-Improvementby @dronomyioSIA-ImprovementAn autonomous research framework for fine-tuning MoE language models, orchestrated by four collaborating agents from Claude Code.AI Cloudself-improving-aiagentshackathon
AI CloudSIA Kernelby @whatdhackSIA KernelA kernel for orchestrating Self-Improving AI agents.AI Cloudself-improving-aiagentshackathon
AI CloudSIA Leverby @mdkrasnowSIA LeverOptimize your optimizer — a lever for self-improving AI harnesses.AI Cloudself-improving-aiagentshackathon
AI CloudSIA — Self-Improving AI Frameworkby @francisco-perez-sorrosalSIA — Self-Improving AI FrameworkA framework to autonomously improve the performance of any AI model or agent on a benchmark task. The reference framework for the SIA Agents hackathon (Hexolabs).AI Cloudself-improving-aiagentshackathon
AI CloudSIA Verifier / Optimizer Labby @skyzerSIA Verifier / Optimizer LabAn interactive verifier/optimizer lab for studying Self-Improving AI Goodhart failures.AI Cloudself-improving-aiagentshackathon
SideLineby @vissh-b · Robotics hackSideLineModular AI sports robot for the coach/referee shortage in youth sports.typescriptqwenvisionrobotics
SkillClawby @lily-zhang · Robotics hackSkillClawMultiple AI agents figure out robot manipulation by themselves — they try, fail, learn from failure.typescriptagentsrobotics
OtherSky is Blueby @sai-kavya · JetBrains hackSky is BlueVS Code extension that shows in real time whether your transformer training is compute- or memory-bound.typescript
TavilySora the Explorerby @m2moizSora the ExplorerA voice-powered language-learning roguelike: speak Spanish, survive the dungeon, watch the AI pipeline light up.Tavilyhackathonvoicegame
SOS-Answered!by @aksh-parekh · Robotics hackSOS-Answered!Autonomous humanoid rescue system with multimodal AI (vision + audio + structural sensing from Oumi) and a fine-tuned world model on Nebius Cloud.robotics
OtherSous Botby @sathvick-reddy-narahari · Robotics hackSous BotAssistive grocery robot for visually impaired and elderly users.robotics
OtherSpecterby @krzysztof-barczynski · Robotics hackSpecterSpace Perception Engine for Crime, Theater, and Exploration Research — robots that see what humans miss in crime scenes, museums, or mystery games.typescriptrobotics
OtherSpeedRunnerby @irina-poslavsky · JetBrains hackSpeedRunnerAI-assisted, human-governed incident response system that cuts P1 outage response and resolution times in half.typescript
OtherSplaticaby @andrey-shelomentsev · Robotics hackSplatica"Jumping into reality" — from live room video to world-modeled robotic control in Isaac Sim.robotics
Token FactoryStrataby @LapintamStrataMolecular subgroup discovery engineToken Factorybiohackbioagentshackathon
Token FactorySubmissionAIby @Bruce WangSubmissionAIData provenance & compliance automation for Phase 2→3 transitionsToken Factorybiohackbioagentshackathon
OtherSwarm Protocolby @eric-nans · Robotics hackSwarm ProtocolAI fleet coordination platform — command center for deploying, organizing, and communicating with fleets of AI agents.typescriptagents
Token FactorySwitchCostby @ayush-ojha · Robotics hackSwitchCostAI inference migration engine — safely move from GPT-4/Claude/Gemini to open-source on Nebius Token Factory while maintaining quality parity.Token Factorytypescript
Token FactorySynthesisOSby @Aryan AcharyaSynthesisOSTurn existing literature into hypotheses without pressing a buttonToken Factorybiohackbioagentshackathon
AI CloudTalk-to-DBby @maniiii07Talk-to-DBNatural-language database agent powered by ChatNebiusAI Cloudagents
OtherTaterGangby @michael-ramos · JetBrains hackTaterGangPlannotator Live — collaborative plan-review surface for agentic engineering.typescriptagents
Token FactoryTeaching Robots to Dreamby @xyuzhTeaching Robots to DreamCommand a Unitree G1 in natural language and watch a trained world model predict the next frame side-by-side with real physics.Token Factoryroboticshackathonworld-model
OtherTeam Big Floofy Catby @robert-cordwell · Robotics hackTeam Big Floofy CatLocal-first AI system for reviewing sensitive medical conversations without centralizing recordings/transcripts.typescript
OtherTeam RankGuardby @isha-s · JetBrains hackTeam RankGuardContext-aware adversarial testing for ML and ranking pipelines, built into the JetBrains IDE via External Tools.jetbrains
Token FactoryTrialSenseby @Linh ChuTrialSenseTrial matching that makes senseToken Factorybiohackbioagentshackathon
OtherTRUEby @yahya-alhinai · JetBrains hackTRUENo review bottlenecks, no merge conflicts, no broken tests.typescriptjetbrainscodexsupabase
OtherVisualCodeby @barkley-dai · JetBrains hackVisualCodeTurns a simple user request into a structured plan and visualizes it as a growing tree graph — branches show what the agent intends to build and how the project is organized.agents
OpenClawvoiceClawby @zhuang-hua · Robotics hackvoiceClawConnect open-source voice hardware (Xiaozhi ESP32) to OpenClaw Agent Gateway — plug in, speak, get AI agent response.OpenClawpythonagentsvoice
OtherVoltaby @saurabh-khire · JetBrains hackVoltaSkills for coding agents to run code systematically.typescriptagents
TavilyWhitespaceby @stephendpurdueWhitespaceCollect brand knowledge with Tavily, then surface and rank high-intent search triggers before ad testing.Tavilyagentshackathonadtech
X-G1by @kaushik-sivakumar · Robotics hackX-G1Rapid-iteration humanoid pipeline for the Unitree G1: Meta Quest 3 + MuJoCo teleop, NVIDIA Sonic for low-latency control, GR00T fine-tuning on Nebius, Nomadic AI for failure-mode diagnostics.mujocorobotics
Otherzipplingby @parth-gala · Robotics hackzipplingAgentic e-commerce customer service resolution and management — handles support resolution agentically based on platform policies, with text and vision.
IntegrationAI CloudNVIDIA NIMNVIDIA NIMSelf-hosted GPU inference microservices, turnkey.AI CloudInference
IntegrationAI CloudAnyscaleAnyscaleScale AI workloads with Anyscale deployed on Managed Kubernetes.AI CloudOrchestration
IntegrationAI ClouddstackdstackInstall dstack and orchestrate AI workloads end-to-end.AI CloudOrchestration
IntegrationAI CloudRun:aiRun:aiOptimize GPU resources for ML/AI workloads on Managed Kubernetes.AI CloudOrchestration
IntegrationAI CloudSkyPilotSkyPilotRun, manage and scale AI workloads with SkyPilot.AI CloudOrchestration
IntegrationAI CloudOuterbounds (Metaflow)Outerbounds (Metaflow)Production-grade ML pipelines via the Outerbounds partnership.AI CloudOrchestration
IntegrationAI CloudMPIrunMPIrunConfigure a Compute GPU cluster and run NCCL tests with MPIrun.AI CloudTraining
IntegrationAI CloudTerraformTerraformOfficial Nebius provider for IaC resource management.AI CloudIaC
IntegrationAI CloudPulumiPulumiManage Nebius resources from Pulumi via the Terraform bridge.AI CloudIaC
IntegrationToken FactoryHugging FaceHugging FaceOpen-source models and datasets via inference API.Token FactoryInference
IntegrationToken FactoryAISuiteAISuiteMulti-provider LLM router with a unified Python API.Token FactoryInference
IntegrationToken FactoryLiteLLMLiteLLMUnified LLM gateway with a Nebius AI provider — use model=nebius/<model-name> to route 30+ Token Factory models across any agent framework.Token FactoryGateway
IntegrationToken FactoryOpenRouterOpenRouterOpenRouter exposes Nebius models through its unified API.Token FactoryGateway
IntegrationToken FactoryPortkeyPortkeyLLM gateway with caching, retries, and budget guardrails.Token FactoryGateway
IntegrationToken FactoryLangChainLangChainChat models, embeddings, retrievers via langchain-nebius.Token FactoryAgents
IntegrationToken FactoryLlamaIndexLlamaIndexRAG framework integration for Nebius inference.Token FactoryAgents
IntegrationToken FactoryCrewAICrewAIOpen-source agentic framework on Token Factory models.Token FactoryAgents
IntegrationToken FactoryGoogle ADKGoogle ADKGoogle's Agent Development Kit, wired to Nebius models.Token FactoryAgents
IntegrationToken FactoryPydantic AIPydantic AIType-safe agent framework with Pydantic validation.Token FactoryAgents
IntegrationToken FactoryAWS StrandsAWS StrandsAmazon's agent SDK, model-agnostic and Nebius-ready.Token FactoryAgents
IntegrationToken FactoryCamel AICamel AIMulti-agent framework with role-playing and task pipelines.Token FactoryAgents
IntegrationToken FactoryMastraMastraTypeScript agent framework with Nebius as a first-class provider.Token FactoryAgents
IntegrationToken FactoryCursor (Token Factory)Cursor (Token Factory)Wire Token Factory in as a custom model provider in Cursor.Token FactoryCoding
IntegrationToken FactoryVS Code (Copilot Chat)VS Code (Copilot Chat)Hugging Face VS Code Chat extension routes Copilot through Nebius.Token FactoryCoding
IntegrationToken FactoryZed (Token Factory)Zed (Token Factory)Configure Zed's inline assistant against Token Factory models.Token FactoryCoding
IntegrationToken FactoryClineClineOpen-source autonomous coding agent for VS Code + JetBrains with Nebius Token Factory as a native provider — pick Nebius, paste your key, drive Qwen3-Coder or GLM-4.5.Token FactoryCoding
IntegrationToken FactoryContinueContinueOpen-source AI coding assistant for VS Code & JetBrains with a native Nebius provider — configure chat (DeepSeek R1) and embeddings (BAAI) in config.yaml.Token FactoryCoding
IntegrationToken FactoryKilo CodeKilo CodeMulti-mode coding agent for VS Code on Token Factory models.Token FactoryCoding
IntegrationToken FactoryLinkupLinkupWeb search and content extraction API for agents.Token FactorySearch
IntegrationToken FactoryPostmanPostmanPre-built Postman collection for the Token Factory API.Token FactoryTooling
IntegrationToken FactoryHeliconeHeliconeLLM observability: traces, costs, prompts, and evals.Token FactoryObservability
IntegrationToken FactoryKeywords AIKeywords AIProduction LLM monitoring — logs, evals, prompt tracking, alerts.Token FactoryObservability
IntegrationTavilyTavily Web Search APITavily Web Search APIReal-time web search, extraction, and crawling for LLMs and agents.TavilySearch
IntegrationTavilyTavily MCP ServerTavily MCP ServerHosted MCP endpoint so any MCP-aware client can search the live web.TavilySearch
IntegrationTavilyTavily Agent SkillsTavily Agent SkillsDrop-in skills that give your agent web search, extraction, and crawling.TavilyAgents
IntegrationTavilyOpenAI Agent BuilderOpenAI Agent BuilderWire Tavily's MCP server into OpenAI Agent Builder.TavilyNo-code
IntegrationTavilyAnthropicAnthropicAdd live web search to Anthropic Claude via Tavily's API.TavilyAgents
IntegrationTavilyArcade.devArcade.devGoverned web search, extraction, and research via Arcade's MCP Gateway.TavilyGateway
IntegrationTavilyCartesiaCartesiaReal-time voice agents that search the web via Cartesia's Line SDK.TavilyAgents
IntegrationTavilyClaudeClaudeUse Tavily across the Claude ecosystem as a Connector or Plugin.TavilyAgents
IntegrationTavilyGoogle ADKGoogle ADKConnect Google's Agent Development Kit to Tavily's search API.TavilyAgents
IntegrationTavilyHaystackHaystackUse Tavily inside Haystack pipelines via `tavily-haystack`.TavilyAgents
IntegrationTavilyLangChainLangChainLangChain's recommended search tool — official partnership.TavilyAgents
IntegrationTavilyLangflowLangflowVisual multi-agent + RAG builds with Tavily search nodes.TavilyNo-code
IntegrationTavilyLibreChatLibreChatSearch, extract, and use Tavily as a built-in agent tool.TavilyAgents
IntegrationTavilyMastraMastraFirst-class Mastra tools for search, extract, crawl, and map.TavilyAgents
IntegrationTavilyOpenClawOpenClawWeb search across WhatsApp, Telegram, Discord, iMessage agents.TavilyAgents
IntegrationTavilyPydantic AIPydantic AIType-safe Tavily tool calls inside Pydantic AI agents.TavilyAgents
IntegrationTavilyStackAIStackAIPlug Tavily into StackAI workflows for real-time web data.TavilyNo-code
IntegrationTavilyVellumVellumBuilt-in web search inside the Vellum Assistant desktop app.TavilyAgents
IntegrationTavilyVercel AI SDKVercel AI SDKSearch, extraction, crawl, and map for Vercel AI agents.TavilyAgents
IntegrationTavilyZapierZapierNo-code Tavily steps across thousands of Zapier integrations.TavilyNo-code
IntegrationToken FactoryOpenCodeOpenCodeTerminal coding agent with a built-in Token Factory provider — drive open models like Kimi K2 and Qwen3-Coder from the CLI.Token FactoryCoding
IntegrationToken FactoryHugging Face smolagentsHugging Face smolagentsMinimalist code-agent framework; set provider="nebius" to run CodeAgents on Token Factory open models.Token FactoryAgents
IntegrationToken FactoryLLM GatewayLLM GatewayOpen-source unified LLM gateway; its Nebius provider exposes Token Factory models behind one OpenAI-compatible API.Token FactoryGateway
IntegrationToken FactoryPipecatPipecatReal-time voice + multimodal agent framework with a NebiusLLMService for low-latency Token Factory inference.Token FactoryAgents
IntegrationTavilyDevinDevinCognition's autonomous coding agent uses Tavily for research-before-coding via the MCP marketplace connector.TavilyCoding
IntegrationTavilyElevenLabsElevenLabsElevenLabs voice agents add live web retrieval by wiring in a Tavily Search API key as a tool.TavilyAgents
IntegrationTavilyGradiumGradiumVoice-AI platform for live speech agents; uses Tavily as its real-time web-context layer.TavilyAgents
IntegrationToken FactoryRequestyRequestyLLM routing gateway; its Nebius provider exposes Token Factory open models behind a unified API.Token FactoryGateway
IntegrationAI CloudDask Cloud ProviderDask Cloud ProviderSpin up Dask clusters on Nebius AI Cloud VMs for distributed Python + data workloads.AI CloudOrchestration
IntegrationTavilyRetoolRetoolBuild internal tools with a Tavily action for live web search inside Retool apps + workflows.TavilyTooling
IntegrationTavilyPipedreamPipedreamConnect Tavily search + extract into thousands of Pipedream automation workflows.TavilyTooling
IntegrationTavilyBuildShipBuildShipLow-code visual backend builder with a Tavily node for web search + extraction.TavilyNo-code
IntegrationTavilySimSimVisual agent builder; drop in the Tavily tool to give agents live web retrieval.TavilyNo-code
IntegrationTavilyActivepiecesActivepiecesOpen-source automation platform with a Tavily MCP piece for web search in flows.TavilyNo-code
IntegrationAI CloudQdrantQdrantDeploy the Qdrant vector database on Nebius AI Cloud for RAG + similarity search.AI CloudTooling
IntegrationAI CloudOpen WebUIOpen WebUISelf-host the Open WebUI chat front-end on Nebius AI Cloud over your own models.AI CloudTooling
IntegrationAI CloudFlowise (Nebius AI Cloud)Flowise (Nebius AI Cloud)Deploy the Flowise low-code agent builder on Nebius AI Cloud GPU infrastructure.AI CloudNo-code
IntegrationAI CloudComfyUIComfyUIRun the ComfyUI node-based diffusion workflow tool on Nebius AI Cloud GPUs.AI CloudTooling
IntegrationAI CloudJupyterLab (Nebius AI Cloud)JupyterLab (Nebius AI Cloud)Launch a GPU-backed JupyterLab environment on Nebius AI Cloud for notebooks + experiments.AI CloudTooling
IntegrationAI Clouddlt (dltHub)dlt (dltHub)Open-source Python ELT library with a Nebius source/destination for data pipelines.AI CloudTooling
IntegrationToken FactoryZed IDEZed IDEGPU-accelerated, collaborative code editor with a Token Factory integration guide for connecting open models to its built-in AI assistant.Token FactoryCoding
IntegrationToken FactoryPineconePineconeKnowledge engine for agents — compile your data into task-ready, cited domain knowledge.Token FactorySearch
IntegrationToken FactoryLangSmithLangSmithTrace, evaluate, and debug agent runs end to end.Token FactoryObservability
IntegrationToken FactoryStripeStripeGive agents safe, approval-gated real-world actions via Stripe MCP.Token FactoryTooling
IntegrationToken FactorySnowglobeSnowglobeSimulate and stress-test agents before production.Token FactoryTooling